<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-2620 P2620-1008 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 11
2 3TC+ AZT 27
3 3TC+ D4T+ IDV 24
4 3TC+ DDC+ IDV 27
5 RTV+ SQV 16
6 DDI+ NFV+ NVP 12

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82A F53L L10I, M36X, K45I, L63S, I64V, E65D, A71V  
>P2620-1008| codons 1-92
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEINLPGRWKPIIIGGIGGLIKVRQYD
QISVDICGHKVIGTVLVGPTPANIIGRNLLTQ

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   V106VA   D123E, D177E, T200R  
>P2620-1008| codons 41-220
LEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
KKKKSATVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRRKIEELRQHLLRWGFYTPDKK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003