<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-2620 P2620-825 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 11
2 3TC+ AZT 27
3 3TC+ D4T+ IDV 24
4 3TC+ DDC+ IDV 27
5 RTV+ SQV 16

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A F53L L10I, L63S, I64V, E65D, A71V  
>P2620-825| codons 1-92
PQITLWQRPIVTIKIGGQLKEALLDTGADDTILEEMNLPGRWKPKIIGGIGGLIKVRQYD
QISVDICGHKVIGTVLVGPTPANIIGRNLLTQ

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005