Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| SWC-1558 | P1558-551 | U.S. | 1997 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | DDI | 29 |
| 2 | 3TC+ D4T+ IDV | 44 |
| 3 | 3TC+ D4T+ NVP | 17 |
| 4 | 3TC+ D4T+ NVP+ RTV+ SQV | 6 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I54V, V82A | F53L | L10I, T12S, K14R, L19I, R41K, L63P, A71V |
| >P1558-551| codons 7-92 QRPIVSIRIGGQIKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGLVKVRQYDQIPIEI CGHKVIGTVLVGPTPANIIGRNLLTQ |
References
| Author | Title | Citation |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Gonzales, MJ | Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. | ARHR, 2003 |