<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-1558 P1558-551 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 29
2 3TC+ D4T+ IDV 44
3 3TC+ D4T+ NVP 17
4 3TC+ D4T+ NVP+ RTV+ SQV 6

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A F53L L10I, T12S, K14R, L19I, R41K, L63P, A71V  
>P1558-551| codons 7-92
QRPIVSIRIGGQIKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGLVKVRQYDQIPIEI
CGHKVIGTVLVGPTPANIIGRNLLTQ

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003