<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-0958 P958-1125 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 56
2 AZT+ DDC 39
3 3TC 71
4 3TC+ D4T+ DLV+ IDV 40

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L   I62V, L63P, A71V  
>P958-1125| codons 1-91
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVRQYD
QVPIEICGHKVIGTVLVGPTPVNIIGRNLLT

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       S68G, I135T, I178M, R211K, L228H  
>P958-1125| codons 30-236
KIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILEPFRKQNPDMVIYQYVDDLYVGSDLEIGQHRTKIEELRQHL
WKWGFYTPDKKHQKEPPFHWMGYELHP

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003