<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-0835 P835-823 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ IDV 27
2 D4T 2

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82A   L10I, L63C, I72V  
>P835-823| codons 7-92
QRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVRQYDQICIEI
CGHKAVGTVLVGPTPANIIGRNLLTQ

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003