<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-9447 P9447-1167 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 54
2 DDC 49
3 D4T 10
4 NRTI 42
5 3TC+ AZT 22
6 3TC+ DDC+ IDV 18
7 3TC+ NVP+ SQV+ AZT 27
8 3TC+ NVP+ SQV+ AZT+ NFV 11
9 3TC+ SQV+ NFV+ RTV+ DDC 2
10 DDC+ RTV+ SQV 29
11 DDC 2

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L74V, M184V, L210W, T215Y K219N Y181I V179D K103R, K122E, S162C, T200A, Q207E, D218E  
>P9447-1167| codons 24-236
WPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKR
TQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIR
YQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIDIIQYVDDLYVGSDLEIGQHRAKIE
ELREHLWRWGFYTPENKHQKEPPFLWMGYELHP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S L10I, K20R, M36I, D60E, Q61E, I62V, L63P, A71V  
>P9447-1167| codons 1-92
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYE
EVPIEICGHKVISTVLVGPTPVNIIGRNLMTQ

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005