<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-5550 P5550-769 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 29
2 D4T+ DDI+ SQV 26
3 DDC+ NFV+ NVP 5

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R   Y181C   V118I, K122E, D123N, Q197K, R211K, F214L, L228H  
>P5550-769| codons 29-236
EKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKRKDSTKWRKLVDFRELNKRTQDFW
EVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGKHRTKIEELRQH
LLKWGLTTPDKKHQKEPPFHWMGYELHP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M   E35D, M36I, N37S, K45R, L63P, L89M  
>P5550-769| codons 1-93
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDISLPGRWKPRMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNVIGRNMMTQI

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005