<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-4003 P4003-782 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 171
2 3TC+ AZT 22
3 3TC+ D4T 16
4 3TC+ SQV 38
5 3TC+ DDC+ NFV+ NVP 14

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, M184MV, T215Y   Y181C V179D D121H, K122E, A158S, R172X, F214L E42V, R83S
>P4003-782| codons 34-237
LVEICTELVKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKSTQDFWEVQLG
IPHPAGLKKKKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSINNETPGIRYQYNVLPQGW
KGSPSIFQSSMTKILEPFSKQNPDIDICQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWG
LYTPDKKHQKEPPFLWMGYELHPD

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005