<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA602 CA1133 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 43
2 3TC+AZT 52
3 AZT+DDI 4
4 3TC+AZT+SQV 21
5 D4T+DDI+SQV 17
6 3TC+AZT+RTV 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N F53FL I13V, E35D, M36I, L63P  
>CA1133| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEDINLPGRWKPKMIGGIGGLIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     K11R, I135X, T200A, Q207R, R211E, D218E  
>CA1132| codons 1-252
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSXNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRRHLLEWGFTTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSW

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005