<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-3834 P3834-871 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ DDC+ IDV 38
2 RTV+ SQV 17
3 DDI+ NFV+ NVP 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V   K103N, V106A, Y181C   R83K, K122Q, I178L, T200A, Q207E, R211K  
>P3834-871| codons 33-239
ALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKKTQDFWEVQL
GIPHPAGLKKNKSATVLDVGDAYFSVPLDQDFRKYTAFTIPSINNETPGIRYQYNVLPQG
WKGSPAIFQSSMTKILEPFRKQNPDLVICQYMDDLYVGSDLEIGQHRAKIEELREHLLKW
GFTTPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005