<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-3636 P3636-1388 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ NFV+ NVP 6
2 3TC+ AZT+ RTV+ SQV 27

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y   K103N   T39A, V118I, I135T, E138Q, S162C, G196E  
>P3636-1388| codons 29-237
EKIKALVEICAELEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFW
EVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSTNNQTPGIRYQYNV
LPQGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIEELRQH
LWRWGFYTPDKKHQKEPPFLWMGYELHPD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, L19M, V77I  
>P3636-1388| codons 1-99
PQITLWQRPLVTIRVGGQMKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005