<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-6100 P6100-1220 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 43
2 NRTI 87
3 3TC+ D4T 76

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D, Q151M, M184V F116Y     V118I, K122E, A158S, I202V, R211K, F214L  
>P6100-1220| codons 21-236
VKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSDKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSIPLDEDFRKYTAFTIPSINNETP
GIRYQYNVLPMGWKGSPSIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRT
KVEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36X, N37E, P39S, I62V, L63PS, A71V, V77I  
>P6100-1220| codons 1-93
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDIELSGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVIGTVLIGPTPVNIIGRNLLTQI

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005