<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-2620 P2620-1486 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 11
2 3TC+ AZT 27
3 3TC+ D4T+ IDV 24
4 3TC+ DDC+ IDV 27
5 RTV+ SQV 16
6 DDI+ NFV+ NVP 41

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, T215Y   K103N, Y181C, G190A   V35I, T39A, R83K, D123E, I167X, D177E, T200R Q91Q*
>P2620-1486| codons 22-233
KQWPLTEEKIKALIEICAELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELN
KKTQDFWEV*LGIPHPAGLKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPG
IRYQYNVLPQGWKGSPAIFQSSMTKMLEPFRKQNPEIVICQYMDDLYVASDLEIGQHRRK
IEELRQHLLRWGFYTPDKKHQKEPPFLWMGYE

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005