<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-2224 P2224-464 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 222
2 DDC 42
3 D4T 12
4 3TC+ AZT 32
5 3TC+ AZT+ SQV 12
6 3TC+ AZT+ IDV 25
7 3TC 2
8 3TC+ NFV+ D4T 1
9 D4T+ NFV 2

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y K219N     E42X, E44X, S68G, I135T, I178M, R211Q R83S
>P2224-464| codons 34-239
LVEICTELXKXGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKSTQDFWEVQLG
IPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGW
KGSPAIFQSSMTKILEPFRKQNPDMVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLWQWG
FYTPDNKHQKEPPFLWMGYELHPDKW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S L63P, A71V, V77I, I93L  
>P2224-464| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVISTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005