<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-1640 P1640-1864 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ SQV 8
2 D4T+ NVP+ RTV+ SQV 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   K103N, V106A   S162C, E169D, I178L, Q207E, R211K  
>P1640-1864| codons 22-233
KQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELN
KRTQDFWEVQLGIPHPAGLKKNKSATVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPG
IRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPDLVIYQYMDDLYVGSDLEIGQHRTK
IEELREHLWKWGFYTPDKKHQKEPPFLWMGYE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I54V, V82T, I84V   K43R, I62V, L63P, I93L A71NT
>P1640-1864| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWRPKIIVGIGGFVKVRQYD
QVPIEICGHKNIGTVLVGPTPTNVIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005