<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-0503 P503-29 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 82
2 NRTI 132
3 AZT+ DDC 20
4 AZT+ DDI 9
5 3TC+ AZT+ RTV 44

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, T215Y     A98G V35I, K43E, V60I, R83K, K122E, D218E  
>P503-29| codons 31-238
IKALIEICTELEEEGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKKTQDFWEV
QLGIPHPGGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLP
QGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLL
RWGFYTPEKKHQKEPPFLWMGYELHPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A   L10LI, K20KR, E35D, N37S, I62V, L63P, A71T, V77I  
>P503-29| codons 1-93
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKTIGTVLIGPTPANIIGRNLLTQI

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005