<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-0211 P211-1225 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 39
2 AZT+ DDC 17
3 D4T 21
4 3TC+ D4T+ IDV 114

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82T L24I L10I, K20R, M36I, I62V, L63P, I66F, A71V  
>P211-1225| codons 1-99
PQITLWQRPIVTIKIGGQLREALIDTGADDTVLEEINLPGRWKPKLIGGIGGFVKVRQYD
QVPIEFCGHKVIGTVLVGPTPTNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y       V35L, A62X, V118I, K122E, E203K, Q207E, H208Y, R211K  
>P211-1225| codons 30-236
KIKALLEICTELEKEGKISKIGPENPYNTPVFXIKKKNSDKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIKELREYL
WKWGFYTPDKKHQKEPPFLWMGYELHP

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003