<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SD-16 SD-16 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 D4T+ DDI+ RTV 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82F V11I L10I, I13V, G16E, E35D, N37S, L63T, I64V, C67Y, V77I  
>SD-16| codons 1-99
PQITLWQRPIITVKIEGQLKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVRQYD
QITVEIYGHKAIGTVLIGPTPFNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R       D177N, I178L, Q197E, R211K, V245T, D250E, T286A, I293V  
>SD-16| codons 1-305
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPNLVI
YQYMDDLYVGSDLEIGEHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTEEAE
LELAE

References
Author Title Citation
Deeks, SG Novel four-drug salvage treatment regimens after failure of a human immunodeficiency virus type 1 protease inhibitor-containing regimen: antiviral activity and correlation of baseline phenotypic drug susceptibility with virologic outcome. J Infect Dis, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005