<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1869 CA11235 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 72
2 D4T+DLV+RTV+SQV 9
3 3TC+AZT+IDV 56
4 D4T+EFV+NFV 32

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82A L24I L10I, I15V, R41K, L63P, T74S  
>CA11235| codons 1-99
PQITLWQRPIVTIKVGGQLKEALIDTGADDTVLEEMNLPGKWKPKLIGGIGGFIKVRQYD
QIPIEICGHKAIGSVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74LV, T215Y   L100I, K103N A98G S3C, K20R, V35I, E44D, R83K, V111I, V118I, I142IV, K166R, I167V, T200A, I202V, E203ED, H208Y, L210S, R211K, H221Y, V245T, E248D, D250E, A272P, K277R M16MI
>CA11210| codons 1-281
PICPIETVPVKLKPGIDGPRVKQWPLTEEKIKALIEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKKTQDFWEVQLGIPHPGGIKKNKSVTVLDIGDAYFSIPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTRVLEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKVDELRQYLSKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPITLPDKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCK

References
Author Title Citation
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005