<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4566 CA11217 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 31
2 3TC+D4T 9
3 3TC+D4T+IDV 168

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L10F, L33I N37C, K43KN, K55R, R57K, L63Q, I64V, K70R, I85V, L89M  
>CA11217| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVIEEMCLPGRWNPKIIGGIGGFVRVKQYD
QIQVEICGHRAIGTVLVGPTPANIVGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V K219R     D123E, D177E, I178V, V179I, R211X, F214L, L228H, A272S, T286A, I293V  
>CA11192| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEVII
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLXWGLTTPDRKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGAKALTEVVPLTEEAE
LE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009