<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1869 CA11210 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 72
2 D4T+DLV+RTV+SQV 9
3 3TC+AZT+IDV 56
4 D4T+EFV+NFV 32

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74LV, T215Y   L100I, K103N A98G S3C, K20R, V35I, E44D, R83K, V111I, V118I, I142IV, K166R, I167V, T200A, I202V, E203ED, H208Y, L210S, R211K, H221Y, V245T, E248D, D250E, A272P, K277R M16MI
>CA11210| codons 1-281
PICPIETVPVKLKPGIDGPRVKQWPLTEEKIKALIEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKKTQDFWEVQLGIPHPGGIKKNKSVTVLDIGDAYFSIPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTRVLEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKVDELRQYLSKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPITLPDKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82A L24I L10I, I15V, R41K, L63P, T74S  
>CA11235| codons 1-99
PQITLWQRPIVTIKVGGQLKEALIDTGADDTVLEEMNLPGKWKPKLIGGIGGFIKVRQYD
QIPIEICGHKAIGSVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005