<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4578 CA11204 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 44
2 AZT+DDC 70
3 D4T 57
4 3TC+D4T 22
5 3TC+D4T+IDV 156

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, T69D, M184V, L210W, T215Y K219R     V21I, V35I, E44D, R83K, K122E, T200A, E203K, H208Y, R211K, K223E, L228H, A272P, K281R, I293V, E297Q  
>CA11204| codons 1-303
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALIEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIKELRQYLWKWGFYTPDRKHQEEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVVPLTQEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S   L10I, M46X, I62V, L63S, V77I, I93IL  
>CA11229| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKXIGGIGGFIKVRQYD
QVSIEICGHKAIGTVLIGPTPVNIIGRSLLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012