<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA596 CA1120 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 AZT+DDI 52
3 DDI 222
4 D4T 17
5 3TC+D4T 26
6 3TC+AZT 48
7 D4T+NFV 26
8 3TC+AZT+SQV 18
9 3TC+D4T+IDV 34

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, L90M G73GC L10I, K20I, E35D, M36I, D60DE, I62V, L63P, I64X, A71AV, I84X  
>CA1120| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVRQYE
QVPXEICGHKVICTVLVGPTPVNXIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210LW, T215Y       L26X, K43EQ, V118X, I135T, R211K  
>CA1119| codons 1-228
PISPIETVPVKLKPGMDGPKVKQWPXTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSXPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005