<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GV-22 Vent22W24 Italy 1998 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+DDC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R       V35T, T39E, S48T, D121H, K122E, D123S, A158S, S162T, K173T, D177E, T200A, Q207E, T215X  
>Vent22W24| codons 30-229
KIKALTEICEEMEKEGKITKIGPENPYNTPVFAIKKKNSDRWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLHESFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPSIFQTSMTKILEPFRTQNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELREHL
LRWGFXTPDKKHQKEPPFLW

References
Author Title Citation
Venturi, G Genotypic resistance to zidovudine as a predictor of failure of subsequent therapy with human immunodeficiency virus type-1 nucleoside reverse-transcriptase inhibitors. Eur J Clin Microbiol Infect Dis, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005