<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GV-8 Vent8W24 Italy 1998 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+DDI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, T215F K219Q   V179D S68X, K82X, V118X, R211K, F214L  
>Vent8W24| codons 30-229
KIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDXTRWRKLVDFRELNXRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSXPLDKDFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILEPFRKQNPDIDIYQYMDDLYVGSDLEIGQHRTKIEELRQHL
LKWGLFTPDQKHQKEPPFLW

References
Author Title Citation
Venturi, G Genotypic resistance to zidovudine as a predictor of failure of subsequent therapy with human immunodeficiency virus type-1 nucleoside reverse-transcriptase inhibitors. Eur J Clin Microbiol Infect Dis, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005