<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1466 CA11103 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 217
2 AZT+ DDI 8
3 3TC+ D4T 34
4 3TC+ D4T+ NFV 60
5 EFV+ ADV 18
6 EFV+ ADV+ NFV 13
7 EFV+ RTV+ IDV 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73C K20V, N37S, R41K, I62IV, L63P, I64V, T74S, V77I  
>CA11103| codons 1-99
PQITLWQRPLVTIKIGGQLVEALLDTGADDTVLEEMSLPGKWKPKIIGGIGGFIKVRQYD
QVPVEICGHKAICSVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N, Y188YC P225PH E6K, K20KR, V35M, K64R, D86E, L100X, K122E, I135T, S162SY, G196K, T200I, F227FY, I257L, A272P, T286A, I293V, E297K  
>CA11012| codons 1-303
PISPIKTVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIRKKDSTKWRKLVDFRELNKRTQEFWEVQLGIPHPAGXKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYMDDLCVGSDLEIKQHRIKIEELRQHLLRWGFTTPDKKHQKEHPYLWMGYELHPDKWT
VQPIVLPEKDSWTVNDLQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTKEAE
LEL

References
Author Title Citation
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: Clinical and genotypic predictors of virologic response. JAIDS, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005