<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4514 CA11096 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 23
2 3TC+AZT+IDV 33
3 D4T+DDI+RTV 90
4 D4T+DDI+NFV 34

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10F, N88D R41K, Q61N, V77I, I93L  
>CA11096| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADNTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
NILIEICGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39A, K122E, D123S, D177E, I178M, E194G, G196E, F214L, D237E, V245M, D250E, A272P, K277R, I293V  
>CA11004| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLGIEQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPEKWT
VQPIMLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
LEL

References
Author Title Citation
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005