<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4305 CA11060 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 218
2 3TC+AZT 22
3 3TC+AZT+RTV 61
4 3TC+AZT+NVP 48
5 D4T+DDC+NFV 45

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   I15V, E35D, M36I, N37D, L63P, V75I  
>CA11060| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADNTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTILVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  A62V, T69G     T7A, K64R, K122E, I135V, Y144F, E204D, T215X, I293V  
>CA10971| codons 1-299
PISPIEAVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIRKKDSGKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRFQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEDLRQHLLRWGFXTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005