<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3955 CA11046 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 66
2 AZT+DDI 59
3 None 68
4 3TC+D4T+IDV 61
5 D4T+DDI+EFV 11
6 D4T+DDI+EFV+NFV 11

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82AT   K20I, K55KR, L63C, A71X, V77I, I93IL  
>CA11046| codons 1-99
PQITLWQRPLVTIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIRVRQYD
QICIEICGHKXIGTVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184MV, L210W, T215Y   K103N   V35M, T39A, S68SG, T139M, A158S, Q207K, R211N  
>CA10956| codons 1-251
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNEMPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRKHLWNWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDS

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009