<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1556 CA11045 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 109
2 AZT+DDC 14
3 DDI 27
4 D4T 21
5 3TC+AZT 58
6 3TC+AZT+IDV 48
7 D4T+NFV 25
8 DDC+NFV+RTV+SQV 16
9 3TC+RTV+SQV 5
10 ABC+EFV+RTV+SQV 44
11 ABC+APV+D4T+RTV 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, I54V, I84V, L90M L10FI, V11I, L33LF, G73S, L89V I13IV, I15V, L19P, K20I, A22AV, E35G, M36I, I62V, L63P, A71I, P79A, I85IV  
>CA11045| codons 1-99
PQITLWQRPFITVKVGGQPIEVLLDTGADDTIFEGINLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKIISTVLVGATPVNVVGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69A_VG, L210W, T215Y A62V     S68G, K122E, I135T, T139I, S162Y, R211K, L228H, V245E  
>CA10935| codons 1-258
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FVIKKKDGAKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNEIPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQ

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003