<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3871 CA11039 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 13
2 AZT+DDC 92
3 3TC+AZT+SQV 16
4 3TC+D4T+IDV 161

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54A, V82F   L10I, I13V, K14R, I15V, K20M, M36V, N37T, I62V, I64V, A71V, L89I  
>CA11039| codons 1-99
PQITLWQRPIVTVRVGGQLMEALLDTGADDTVLEEVTLPGRWKPKMIGGIGGFAKVRQYD
QVLVEICGHKVIGTVLVGPTPFNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y K219R   V108I V35I, K43Q, E44D, V60I, V118I, K122E, D123N, I135M, G196E, H208Y, R211K, H221Y, A272P, I293IL, G335S, M357MT, E370EK, A371V, I375V, A400T, E404D, V435E, K451R, D460N, S468P, H483HY, L491LQ, S519N, K530KR  
>CA10950| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEQDGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSIPL
DENFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQYLWKWGFYTPDRKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVLPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQSQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTKVVQKVATESIVIWGKTPKFKLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIEGAETFYVDGAANRETRLGKAGYVTNRGRQKVVPLTDTTNQKTELQ
AIYLALQDSGQEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKERVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009