<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4462 CA11024 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15V, M36L, N37E, I62V, L63S, I64V  
>CA11024| codons 1-99
PQITLWQRPLVTVRVGGQLKEALLDTGADDTVLEELELPGRWKPKMIGGIGGFIKVRQYD
QVSVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35I, I135T, A158S, R211K, F214L, T286A, E297K, I329V, Q334H, R356K, K366R, Q367L, K390R, V435VI, N447S, V466I, L491S, K558KR, V559I  
>CA10934| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGHGQWTYQIYQEPFKNLKTGKYAKMRGA
HTNDVRLLTEAVQKIATESIVIWGKTPKFRLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAASRETKLGKAGYVTDRGRQKIVSLTDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRRIL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005