<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1341 CA11022 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 AZT+DDI 100
3 AZT+DDC 40
4 D4T 26
5 AZT 38
6 3TC+AZT+IDV 72
7 3TC+AZT+DLV+RTV+SQV 38
8 3TC+ADV+AZT+EFV+NFV+SQV 53
9 ABC+ADV+EFV 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M Q58E, G73T L10I, L19I, R41K, I62V, L63P, A71I, V77I, I93L  
>CA11022| codons 1-99
PQITLWQRPIVTIKIGGQIKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFVKVREYD
QVPIEICGHKIITTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y K219N L100LI, K103N   V35VM, T39A, E44D, K122E, Q174R, G196E, Q197K, Q207E, R211K, Q278H, T286A, I293V  
>CA10932| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDIVI
YQYVDDLYVGSDLEIEKHRTKIEELREHLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGAKALTEVVPLTEEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005