<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4510 CA10999 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NVP 12
2 NVP+3TC 9
3 3TC+AZT+NFV 15
4 DDI+NFV+SQV 5
5 EFV+ABC+NFV+SQV 49
6 RTV+SQV 10
7 APV+RTV+SQV 6

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, L74I, L210W T215C, K219E K101E, Y181I, G190A V108I E6D, T69N, K122E, I135M, S162C, E169D, Q174K, T200TA, D218E  
>CA10999| codons 1-258
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKKNPDIVI
IQYMDDLYVASDLEIGQHRAKIEELRQHLWRWGFCTPEEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82T, I84V V11I L10I, I13V, K20V, M36I, L63P, A71T, I72V  
>CA11092| codons 1-99
PQITLWQRPIITVKIGGQLVEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKTVGTVLVGPTPTNVIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005