<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4490 CA10973 U.S. 1998 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+SQV 14

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4S, E28K, K32E, V35K, E36A, T39E, S48T, V60VI, V118I, K122E, D123N, I142M, K173A, Q174K, T200A, Q207E, R211K, F214L, T240TA, V245Q F124FV, Y127YD
>CA10973| codons 1-256
PISSIETVPVKLKPGMDGPKVKQWPLTKEKIEALKAICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENVRKDTAFTIPSINNETPGMRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWA
VQPIQLPEKDSWTVND

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, K45KR, L63P, H69K, L89LM, I93L  
>CA11062| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPRMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001