<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4486 CA10967 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 39
2 3TC+D4T 18
3 3TC+D4T+SQV 30
4 3TC+D4T+IDV 78
5 DDI+NFV+NVP 67

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V A62V, V75T Y181C   K20R, S48T, K49R, V90I, D123E, S162DN, E169D, R211RK, K223KE, L228LR, V245K, A272P, K277R, L283I, I293V, P294Q, E297K  
>CA10967| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKITRIGPENPYNTPV
FVIKKKDSTKWRKVTDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILDPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQEEPPFRWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTEVVQLTKEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S I15V, Q18H, K20I, E35D, M36I, P39S, I62V, L63P, A71V, I72L  
>CA11056| codons 1-99
PQITLWQRPLVTIKVGGHLIEALLDTGADDTVLEDINLSGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVLSTVLVGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012