<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4485 CA10966 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 57
2 D4T 13
3 AZT 39
4 3TC+AZT 13
5 3TC+AZT+RTV 61
6 D4T+NFV+NVP 13
7 DDI+DLV+RTV+SQV 89

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, D67N, Y115F, Q151M V75I, F77L, F116Y, K219E Y181C K101HQ S68G, D123E, I135V, S163SI, K166KR, R172RK, D177E, I202V, R211A, V245M, A272P, K277R, T286A, E297K  
>CA10966| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKRKNGTKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLHKKKSVTVLDVGDAFYSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPMGWKGSPAIFQSIMTRILEPFKKQNPEIVI
CQYMDDLYVGSDLEIGQHRTKVEELRQHLLAWGFTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L23LI, F53FL L10I, K20R, E35D, M36I, D60E, L63P, A71V, I93L  
>CA11055| codons 1-99
PQITLWQRPIVTIKIGGQLREAILDTGADDTVLEDINLPGRWKPKIIGGIGGLVKVRQYE
QIPIEICGHKVIGTVLVGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005