<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-0211 P211-11 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 39
2 AZT+ DDC 17
3 D4T 21
4 3TC+ D4T+ IDV 35

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82A   M36I, I62V, L63P  
>P211-11| codons 1-92
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEINLPGRWKPKLIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPANIIGRNLLTQ

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, T215Y       V35L, K122E, Q207E, H208Y, R211K  
>P211-11| codons 30-236
KIKALLEICTELEKEGKISKIGPENPYNTPVFAIKKKNSDRWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELREYL
LKWGFYTPDKKHQKEPPFLWMGYELHP

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005