<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4420 CA10831 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI 65
2 D4T+ 3TC+ NFV 47
3 ADV+ NVP+ IDV 13
4 ADV+ ABC+ IDV+ NVP 30
5 NVP+ IDV+ ABC 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M Q58E, G73S L10I, I62V, L63P, H69Y, A71V, I72E, V77I, I93L  
>CA10831| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVREYD
QVPIEICGYKVESTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74I, V75M, L210W, T215Y   K101E, K103N, Y181C   E28K, T39TA, K43E, E44A, K104R, V118I, K122E, G196E, E203V, Q207E, H208Y, R211K, R284K, I293V, E297A  
>CA10629| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALVEICAELEEAGKISKIGPENPYNTPV
FAIKKKNSDKWRKIMDFRELNKRTQDFWEVQLGIPHPAGLEKNRSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIEQHRTKIVELREYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGTKALTEVVPLTAEAE
LE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005