<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2193 CA10793 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 87
2 3TC+AZT 70
3 3TC+AZT+NFV 31
4 D4T+IDV+NVP 58
5 3TC+EFV+NFV+SQV 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82A, I84IV L24I, Q58E L10I, L63C, I64V, V77I T74R
>CA10793| codons 3-99
ITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVREYDQI
CVEICGHKAIGRVLIGPTPANVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184I K219Q K103N, Y181C   K20R, V60I, T69N, A98S, K122E, D123E, I135T, E194Q, G196E, D218E, V245E, I293V, A304G  
>CA10583| codons 1-304
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYIDDLYVGSDLQIEQHRTKIEELRQHLLRWGFTTPEQKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELG

References
Author Title Citation
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005