<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4367 CA10779 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 173
2 AZT+DDI 47
3 DDI 95
4 3TC+AZT+SQV 12
5 AZT+ 3TC+ IDV 87
6 D4T+ NVP+ NFV+ 3TC 4
7 3TC+ IDV+ NFV+ AZT 66

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10I, K20R, E35D, M36I, L63P, A71V, I72V, I93L  
>CA10779| codons 1-99
PQITLWQRPIVTIKIGGQLREALIDTGADDTVLEDINLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVVGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       K20R, K43E, V118I, T200I, R211K  
>CA10569| codons 1-259
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRIKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQK

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009