<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1823 CA10774 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ DDI+ DDC+ D4T+ AZT NA
2 RTV+ NFV+ IDV+ SQV NA
3 Unknown NA
4 SQV+ NFV+ AZT+ 3TC NA
5 Unknown NA
6 RTV+ IDV+ D4T 12

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A K43T L10I, I13V, I15V, Q61N, T74S  
>CA10774| codons 1-99
PQITLWQRPIVTVKVGGQLKEALLDTGADDTVLEEMNLPGRWTPKMIVGIGGFVKVRQYD
NILIEICGHKAIGSVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219Q     V118I, K122E, I135T, I180V, F214L, A272AP  
>CA10564| codons 1-273
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVV
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPG

References
Author Title Citation
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005