<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1511 CA10770 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 8
2 3TC+AZT+SQV 27
3 3TC+AZT+APV+SQV 11
4 D4T+NFV+NVP 22
5 D4T+NFV+NVP 15
6 Unknown 10

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   K20M, M36V, L63P, A71V  
>CA10770| codons 1-99
PQITLWQRPLVTIKIGGQLMEALLDTGADDTVLEEVNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R   Y181C   T200A, F214L, H221Y, E291D, E297K, A304G R72RG
>CA10561| codons 1-304
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWGKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGLTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTDVIPLTKEAE
LELG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005