<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4345 CA10753 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 130
2 D4T+IDV 48
3 3TC+NFV 65
4 RTV+SQV 35

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48Q, I54T, V82F, L90M K43T L10I, E35D, M36I, N37D, I62V, L63T, I72V, V77I, L89M, I93L  
>CA10753| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDIDLPGRWTPKIIQGIGGFTKVRQYD
QVTIEICGHKAVGTVLIGPTPFNIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, M184MV T215D     K20R, E44D, S68SG, V90VI, V118I, A158AP, A272P, V292I, E300EQ N265ND, E291DV
>CA10543| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKDGTKWRKVVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPPIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFDTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLDWASQIYPGIKVKQLCKLLRGTKALTDIIPLTEEAQ

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005