<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1405 CA10744 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 122
2 3TC+AZT+IDV 61
3 D4T+DDI+NFV 48
4 D4T+DDI+NFV+SQV 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, N88S   L63A, I72V, V77I Q2Q*
>CA10744| codons 1-99
P*ITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVRQYD
QIAIEICGHKAVGTVLIGPTPVNIIGRSLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       K43N, V60VI, K122E, I142V, R211K, A272P, K277R, M357T, A360T, K390R, A400T, L452S, S468P, T470S, L503I, V548I  
>CA10534| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGT
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKSGKAGYVTDRGRQKVVPLSDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYAIGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQIDKLVSAGIRKVL

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005