<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
El-IC3597 IC3597 Cote d'Ivoire 1995 HIV1 A PBMC Unknown

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15M, K20I, A22P, E35K, M36I, N37D, R41K, I64M, H69K, K70R, L89M  
>IC3597| codons 1-99
PQITLWQRPLVTVRMGGQLIEPLLDTGADDTVLEKIDLPGKWKPKMIGGIGGFIKVRQYD
QILMEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Ellenberger, DL Genetic analysis of human immunodeficiency virus in Abidjan, Ivory Coast reveals predominance of HIV type 1 subtype A and introduction of subtype G. ARHR, 1999