<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1581 CA10737 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 30
2 SQV 21
3 3TC+ SQV 8
4 3TC+ D4T+ SQV 12
5 3TC+ DDI+ D4T+ SQV 13
6 3TC+ DDI+ IDV+ D4T+ SQV 28
7 3TC+ DDI+ SQV+ NVP+ IDV 12
8 3TC+ NFV+ SQV 34
9 DDI+ SQV+ RTV 11
10 DDI+ ABC+ EFV+ SQV+ RTV 27
11 DDI+ ABC+ ADV+ SQV+ RTV 21
12 None 8

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, K43R, D60DE, Q61E, I62V, L63Q, C67Y, A71V, V77I, I93L  
>CA10737| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWRPKMIGGIGGFIKVRQYE
EVQIEIYGHKVIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y       G196DE, R211G, A272P, K277R, T286A, E297K  
>CA10528| codons 1-298
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIDQHRTKIEELRQHLLGWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005