<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4325 CA10725 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 74
2 AZT+DDI 22
3 3TC+AZT 26
4 3TC+AZT+IDV 96
5 D4T+EFV+NFV 61

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82T, N88S   L10I, L19S, I62V, L63P, A71V, I85V, I93L  
>CA10725| codons 1-99
PQITLWQRPIVTIKIGGQSKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGHKVIGTVLVGPTPTNIVGRSLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F V75VI, K219E L100LI, K103N   S68SG, K122E, D123S, I132IL, Y144X, K166R, I202V, R211RS, L228LR A267AG
>CA10516| codons 1-268
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNGTRWRKLIDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTLPSINNETPGIRXQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELRQHLLSWGFFTPDEKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWGS

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001