Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA790 | CA10724 | U.S. | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 365 |
| 2 | AZT+DDC | 22 |
| 3 | 3TC+AZT | 31 |
| 4 | 3TC+AZT+IDV | 9 |
| 5 | 3TC+D4T+IDV | 60 |
| 6 | D4T+DDI+RTV+SQV | 58 |
| 7 | D4T+DDI+EFV+RTV+SQV | 28 |
| 8 | D4T+DDI+EFV+SQV | 18 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46I | L24I, G73S | L10I, I13V, K14KR, L63P, A71T, I72V, I93L |
| >CA10724| codons 1-99 PQITLWQRPIVTVRIGGQLKEALIDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD QIPIEICGHKTVSTVLVGPTPVNIIGRNLLTQLGCTLNF |
References
| Author | Title | Citation |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
| Shulman, NS | Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: clinical and genotypic predictors of virologic response. | JAIDS, 2000 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Gonzales, MJ | Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. | ARHR, 2003 |