<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA790 CA10724 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 365
2 AZT+DDC 22
3 3TC+AZT 31
4 3TC+AZT+IDV 9
5 3TC+D4T+IDV 60
6 D4T+DDI+RTV+SQV 58
7 D4T+DDI+EFV+RTV+SQV 28
8 D4T+DDI+EFV+SQV 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I L24I, G73S L10I, I13V, K14KR, L63P, A71T, I72V, I93L  
>CA10724| codons 1-99
PQITLWQRPIVTVRIGGQLKEALIDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKTVSTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: Clinical and genotypic predictors of virologic response. JAIDS, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003