<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4307 CA10699 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 61
2 3TC+D4T+IDV 35
3 DDI+RTV+SQV 61
4 D4T+DDI+RTV+SQV 44
5 3TC+D4T+IDV+RTV 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I54V, V82T   Q7X, L10V, I15V, L19I, M36I, N37S, I64V  
>CA10699| codons 5-99
LWHRPVVTIKVGGQIKEALLDTGADDTVLEEISLPGRWKPKIIVGIGGFVKVRQYDQILV
EICGHKAIGTVLVGPTPTNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K122E, I178M, M230X  
>CA10496| codons 1-253
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWXGYELHPDKWT
VQPIVLPEKDSWT

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009